Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: P09597
RecName: 30S ribosomal protein S8, chloroplastic
Begin-End: 4-134
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
DTIADIITCIRNADMNRKGTVRIVSTNITENIVKILLREGFIENARKHQERNKYFLVLTL
RHRRNKKGPYLNTFHLKRVSRPGLRIYSNYQRIPRILGGMGIAILSTSRGIMTDREARLE
GIGGEILCYIW
Structures of the domain P09597 4-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8r X-ray 3.7 h 4-134 None
5mmj X-ray 3.65 h 4-134 None


© NPIDB team 2003 - 2021

text