Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P09884
RecName: DNA polymerase alpha catalytic subunit
Begin-End: 369-711
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIM
KFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFL
MNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQ
NAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVK
VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS
NMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSEL
Structures of the domain P09884 369-711
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qcl X-ray 2.2 A 369-711 None
6as7 X-ray 2.95 A 369-711 None
4q5v X-ray 2.52 A 369-711 None
4q5v X-ray 2.52 E 369-711 None
5iud X-ray 3.3 J 369-711  L-Bb 
5iud X-ray 3.3 D 369-711  L-Bb 
5iud X-ray 3.3 G 369-711 None
5iud X-ray 3.3 A 369-711  L-Bb 


© NPIDB team 2003 - 2021

text