Pfam domain
Pfam family: Penicillinase_R (PF03965.18)
Uniprot AC: P0A042
RecName: Penicillinase repressor
Begin-End: 8-122
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
ISMAEWDVMNIIWGKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIY
FYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILND
Structures of the domain P0A042 8-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xsd X-ray 2.7 A 8-122 None


© NPIDB team 2003 - 2021

text