Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P0A0K8
RecName: DNA gyrase subunit B
Begin-End: 430-542
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
EIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGI
GGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQP
Structures of the domain P0A0K8 430-542
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5bs3 X-ray 2.65 D 430-542 None
5bs3 X-ray 2.65 B 430-542 None
4plb X-ray 2.69 B 430-542  H-Bb L-Bb L-Mn 
4plb X-ray 2.69 D 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 M 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 K 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 B 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 D 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 u 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 s 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 U 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 S 429-541  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 m 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 k 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 d 430-542  H-Bb L-Bb L-Mn 
6qx2 X-ray 3.4 b 430-542  H-Bb L-Bb L-Mn 
6qx1 X-ray 2.65 B 430-542  H-Bb S-Bb L-Bb L-Mn 
6qx1 X-ray 2.65 D 430-542  H-Bb S-Bb L-Bb L-Mn 
6z1a X-ray 2.3 D 430-542  H-Bb L-Bb L-Mn 
6z1a X-ray 2.3 B 430-542  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text