Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P0A0K8
RecName: DNA gyrase subunit B
Begin-End: 537-593
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb 

Sequence:
VYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWE
Structures of the domain P0A0K8 537-593
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qx1 X-ray 2.65 D 544-634  H-Bb 
6qx1 X-ray 2.65 B 544-634  H-Bb 


© NPIDB team 2003 - 2021

text