Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P0A0K8
RecName: DNA gyrase subunit B
Begin-End: 580-634
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb 

Sequence:
YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIE
Structures of the domain P0A0K8 580-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5bs3 X-ray 2.65 D 544-634 None
5bs3 X-ray 2.65 B 544-634 None
4plb X-ray 2.69 D 544-634  H-Bb 
4plb X-ray 2.69 B 544-634  H-Bb 
6qx2 X-ray 3.4 M 544-634  H-Bb 
6qx2 X-ray 3.4 K 539-634  H-Bb 
6qx2 X-ray 3.4 D 544-634  H-Bb 
6qx2 X-ray 3.4 B 539-634  H-Bb 
6qx2 X-ray 3.4 u 544-634  H-Bb 
6qx2 X-ray 3.4 s 539-634  H-Bb 
6qx2 X-ray 3.4 U 544-634  H-Bb 
6qx2 X-ray 3.4 S 539-632  H-Bb 
6qx2 X-ray 3.4 m 544-634  H-Bb 
6qx2 X-ray 3.4 k 539-634  H-Bb 
6qx2 X-ray 3.4 b 539-634  H-Bb 
6z1a X-ray 2.3 D 544-634  H-Bb 
6z1a X-ray 2.3 B 544-634  H-Bb 


© NPIDB team 2003 - 2021

text