Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P0A0K8
RecName: DNA gyrase subunit B
Begin-End: 586-634
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
MNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIE
Structures of the domain P0A0K8 586-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qx2 X-ray 3.4 d 545-628  H-Bb 


© NPIDB team 2003 - 2021

text