Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: P0A3U0
RecName: Group II intron-encoded protein LtrA
Begin-End: 89-361
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
IAKKNSKKMRPLGIPTFTDKLIQEAVRIILESIYEPVFEDVSHGFRPQRSCHTALKTIKR
EFGGARWFVEGDIKGCFDNIDHVTLIGLINLKIKDMKMSQLIYKFLKAGYLENWQYHKTY
SGTPQGGILSPLLANIYLHELDKFVLQLKMKFDRESPERITPEYRELHNEIKRISHRLKK
LEGEEKAKVLLEYQEKRKRLPTLPCTSQTNKVLKYVRYADDFIISVKGSKEDCQWIKEQL
KLFIHNKLKMELSEEKTLITHSSQPARFLGYDI
Structures of the domain P0A3U0 89-361
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7d0f X-ray 5 C 89-361 None
7d0g X-ray 5 C 89-361 None
5g2x X-ray 3.8 C 89-361 None
7d1a X-ray 3.8 C 89-361 None


© NPIDB team 2003 - 2021

text