Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P0A4M0
RecName: DNA gyrase subunit B
Begin-End: 428-540
Organism: Streptococcus pneumoniae
Interaction Mode:   

Sequence:
ELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGF
GAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQP
Structures of the domain P0A4M0 428-540
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4z2d X-ray 3.38 C 428-540  H-Bb L-Bb 
4z2d X-ray 3.38 D 428-540  H-Bb S-Bb L-Bb L-Mn 
4z2e X-ray 3.46 C 428-540  H-Bb L-Bb 
4z2e X-ray 3.46 D 428-540  H-Bb L-Bb L-Mn 
4z2c X-ray 3.19 D 428-540  H-Bb L-Bb L-Mn 
4z2c X-ray 3.19 C 428-540  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text