Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P0A4T9
RecName: HTH-type transcriptional activator TipA
Begin-End: 3-71
Organism: Streptomyces lividans
Interaction Mode:   

Sequence:
YSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQILFYRELGFPL
DEVAALLDD
Structures of the domain P0A4T9 3-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vz4 X-ray 2.9 A 3-77 None


© NPIDB team 2003 - 2021

text