Pfam domain
Pfam family: AP_endonuc_2 (PF01261.26)
Uniprot AC: P0A6C1
RecName: Endonuclease 4
Begin-End: 19-278
Organism: Escherichia coli
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
IRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGH
PVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQ
GVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEK
TFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPL
ILETINPDIWAEEIAWLKAQ
Structures of the domain P0A6C1 19-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nqj X-ray 2.45 B 19-278 None
2nqj X-ray 2.45 A 19-278  S-Bb L-Bb L-Mj L-Mn 
2nq9 X-ray 1.45 A 19-278  S-Bb L-Bb L-Mj L-Mn 
1qum X-ray 1.55 A 19-278  S-Bb L-Bb L-Mj L-Mn 
4k1g X-ray 1.9 B 19-278  L-Bb L-Mj L-Mn 
4k1g X-ray 1.9 A 19-278  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text