Pfam domain
Pfam family: NusB (PF01029.20)
Uniprot AC: P0A780
RecName: Transcription antitermination protein NusB
Begin-End: 7-132
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLM
KPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSHKFVNGV
LDKAAP
Structures of the domain P0A780 7-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 L 7-132 None
6tqn X-ray 3.8 B 7-132 None
6tqo X-ray 3.8 B 7-132 None


© NPIDB team 2003 - 2021

text