Pfam domain
Pfam family: NusB (PF01029.20)
Uniprot AC: P0A782
RecName: Transcription antitermination protein NusB
Begin-End: 7-132
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
RRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLM
KPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSHKFVNGV
LDKAAP
Structures of the domain P0A782 7-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gov X-ray 3.7 B 7-132 None


© NPIDB team 2003 - 2021

text