Pfam domain
Pfam family: RecA (PF00154.23)
Uniprot AC: P0A7G6
RecName: Protein RecA
Begin-End: 9-270
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGP
ESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE
ICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNT
LLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVV
KNKIAAPFKQAEFQILYGEGIN
Structures of the domain P0A7G6 9-270
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cmw X-ray 2.8 C 37-269 None
3cmw X-ray 2.8 C 1008-1269 None
3cmw X-ray 2.8 C 2008-2269 None
3cmw X-ray 2.8 C 4008-4269 None
3cmw X-ray 2.8 C 3008-3269 None
3cmw X-ray 2.8 A 37-269 None
3cmw X-ray 2.8 A 2008-2269 None
3cmw X-ray 2.8 A 3008-3269 None
3cmw X-ray 2.8 A 4008-4269 None
3cmw X-ray 2.8 A 1008-1269 None
3cmt X-ray 3.15 D 4008-4269 None
3cmt X-ray 3.15 D 37-269  S-Bb S-Mj L-Bb L-Mj L-Mn 
3cmt X-ray 3.15 D 2008-2269  H-Bb L-Bb L-Mj L-Mn 
3cmt X-ray 3.15 D 1008-1269  H-Bb S-Bb L-Bb L-Mj L-Mn 
3cmt X-ray 3.15 D 3008-3269  H-Bb L-Mn 
3cmt X-ray 3.15 A 4008-4269 None
3cmt X-ray 3.15 A 3008-3269  H-Bb L-Mn 
3cmt X-ray 3.15 A 2008-2269  H-Bb L-Bb L-Mj L-Mn 
3cmt X-ray 3.15 A 1008-1269  H-Bb S-Bb L-Bb L-Mj L-Mn 
3cmt X-ray 3.15 A 37-269  S-Bb S-Mj L-Mj L-Mn 
3cmx X-ray 3.4 D 4008-4269  H-Bb H-Mn 
3cmx X-ray 3.4 D 37-269  S-Bb S-Mj L-Mj L-Mn 
3cmx X-ray 3.4 D 1008-1269  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3cmx X-ray 3.4 D 3008-3269  H-Bb H-Mn L-Bb L-Mj L-Mn 
3cmx X-ray 3.4 D 2008-2269  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3cmx X-ray 3.4 A 4008-4269  H-Bb H-Mn 
3cmx X-ray 3.4 A 3008-3269  H-Bb H-Mn L-Bb L-Mj L-Mn 
3cmx X-ray 3.4 A 2008-2269  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3cmx X-ray 3.4 A 37-269  S-Bb S-Mj L-Mj L-Mn 
3cmx X-ray 3.4 A 1008-1269  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3cmu X-ray 4.2 A 5008-5269 None
3cmu X-ray 4.2 A 4008-4269 None
3cmu X-ray 4.2 A 37-269 None
3cmu X-ray 4.2 A 1008-1269 None
3cmu X-ray 4.2 A 3008-3269 None
3cmu X-ray 4.2 A 2008-2269 None


© NPIDB team 2003 - 2021

text