Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.16)
Uniprot AC: P0A7J7
RecName: 50S ribosomal protein L11
Begin-End: 9-67
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSF
Structures of the domain P0A7J7 9-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3deg X-ray 10.9 H 8-66 None
5aka X-ray 5.7 I 8-66 None
6i0y X-ray 3.2 I 8-66 None
5gaf X-ray 4.3 J 9-67 None
3j5l X-ray 6.6 I 8-66 None
3j7z X-ray 3.9 I 8-66 None
3j0d X-ray 11.1 G 8-66 None
6s0k X-ray 3.1 J 9-67 None
3j8g X-ray 5 I 8-66 None
6xz7 X-ray 2.1 I 9-67 None
5gag X-ray 3.8 J 9-67 None
5ady X-ray 4.5 I 8-66 None
4uy8 X-ray 3.8 I 8-66 None
3eq3 X-ray 9 I 8-66 None
2rdo X-ray 9.1 I 8-66 None
3ep2 X-ray 9 I 8-66 None
3eq4 X-ray 12 I 8-66 None
2j28 X-ray 8 I 8-66 None
5gah X-ray 3.8 J 9-67 None
5gad X-ray 3.7 J 9-67 None
6wnt X-ray 3.1 i 8-66 None


© NPIDB team 2003 - 2021

text