Pfam domain
Pfam family: Ribosomal_L9_N (PF01281.21)
Uniprot AC: P0A7R1
RecName: 50S ribosomal protein L9
Begin-End: 1-47
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF
Structures of the domain P0A7R1 1-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aka X-ray 5.7 H 1-47 None
6i0y X-ray 3.2 H 2-48 None
5gaf X-ray 4.3 H 1-47 None
6gbz X-ray 3.8 H 1-47 None
6gc4 X-ray 4.3 H 1-47 None
3j5l X-ray 6.6 H 1-47 None
3j7z X-ray 3.9 H 1-47 None
6s0k X-ray 3.1 H 1-47 None
6gc8 X-ray 3.8 H 1-47 None
5gae X-ray 3.33 H 60-106 None
4csu X-ray 5.5 H 1-47 None
3j8g X-ray 5 H 1-47 None
7bv8 X-ray 3.14 H 1-47 None
5gag X-ray 3.8 H 1-47 None
5ady X-ray 4.5 H 1-47 None
4uy8 X-ray 3.8 H 1-47 None
2rdo X-ray 9.1 H 1-47 None
6gc0 X-ray 3.8 H 1-47 None
3bbx X-ray 10 H 1-47 None
2j28 X-ray 8 H 1-47 None
5gah X-ray 3.8 H 1-47 None
5gad X-ray 3.7 H 1-47 None
6qul X-ray 3 H 1-47 None
6wnt X-ray 3.1 g 1-47 None


© NPIDB team 2003 - 2021

text