Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P0A7R5
RecName: 30S ribosomal protein S10
Begin-End: 7-101
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYE
IRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQIS
Structures of the domain P0A7R5 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 E 7-101 None
5no3 X-ray 5.16 J 7-101 None
5no4 X-ray 5.16 J 7-101 None
6tqn X-ray 3.8 E 7-101 None
2ykr X-ray 9.8 J 7-101 None
5no2 X-ray 5.16 J 7-101 None
4a2i X-ray 16.5 J 7-101 None
4adv X-ray 13.5 J 7-101 None
5my1 X-ray 7.6 J 7-101 None
5me0 X-ray 13.5 J 7-101 None
5me1 X-ray 13.5 J 7-101 None
6xe0 X-ray 6.8 I 7-101 None
5uz4 X-ray 5.8 J 7-101 None
6nqb X-ray 3.8 J 7-101 None
6tqo X-ray 3.8 E 7-101 None
6w7m X-ray 3.8 J 7-101 None
6w77 X-ray 3.6 J 7-101 None
6w7n X-ray 3.4 J 7-101 None
6w6k X-ray 3.6 J 7-101 None


© NPIDB team 2003 - 2021

text