Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P0A7R7
RecName: 30S ribosomal protein S10
Begin-End: 7-101
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
RIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYE
IRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQIS
Structures of the domain P0A7R7 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gov X-ray 3.7 E 7-101 None


© NPIDB team 2003 - 2021

text