Pfam domain
Pfam family: Ribosomal_S11 (PF00411.21)
Uniprot AC: P0A7R9
RecName: 30S ribosomal protein S11
Begin-End: 19-128
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYG
IKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRR
Structures of the domain P0A7R9 19-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 K 19-128 None
5no4 X-ray 5.16 K 19-128 None
6o7k X-ray 4.2 q 18-127 None
2ykr X-ray 9.8 K 18-127 None
5no2 X-ray 5.16 K 19-128 None
4a2i X-ray 16.5 K 18-127 None
4adv X-ray 13.5 K 18-127 None
5my1 X-ray 7.6 K 18-127 None
5me0 X-ray 13.5 K 19-128 None
5me1 X-ray 13.5 K 19-128 None
6xe0 X-ray 6.8 J 18-127 None
6w7m X-ray 3.8 K 19-128 None
6w77 X-ray 3.6 K 19-127 None
6w6k X-ray 3.6 K 18-127 None


© NPIDB team 2003 - 2021

text