Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P0A7S3
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEG
HNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK
Structures of the domain P0A7S3 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3deg X-ray 10.9 D 11-122 None
3j0d X-ray 11.1 I 10-121 None
3j0e X-ray 9.9 F 11-122 None
6w7w X-ray 3.9 K 12-123 None
5u4j X-ray 3.7 l 12-123 None
2ykr X-ray 9.8 L 11-122 None
4a2i X-ray 16.5 L 11-122 None
4adv X-ray 13.5 L 11-122 None
3eq3 X-ray 9 L 11-122 None
5my1 X-ray 7.6 L 11-122 None
3ep2 X-ray 9 L 11-122 None
3eq4 X-ray 12 L 11-122 None
5me0 X-ray 13.5 L 12-123 None
5me1 X-ray 13.5 L 12-123 None
6xe0 X-ray 6.8 K 11-122 None
6w7m X-ray 3.8 L 12-123 None
6w77 X-ray 3.6 L 12-123 None
6w7n X-ray 3.4 L 11-121 None
6w6k X-ray 3.6 L 11-122 None


© NPIDB team 2003 - 2021

text