Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P0A7S3
RecName: 30S ribosomal protein S12
Begin-End: 28-123
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRV
KDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK
Structures of the domain P0A7S3 28-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zn1 X-ray 14.1 L 27-122 None


© NPIDB team 2003 - 2021

text