Pfam domain
Pfam family: Ribosomal_S3_C (PF00189.22)
Uniprot AC: P0A7V3
RecName: 30S ribosomal protein S3
Begin-End: 120-202
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLR
ADIDYNTSEAHTTYGVIGVKVWI
Structures of the domain P0A7V3 120-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no4 X-ray 5.16 C 120-202 None
2ykr X-ray 9.8 C 119-201 None
4a2i X-ray 16.5 C 119-201 None
4adv X-ray 13.5 C 119-201 None
5my1 X-ray 7.6 C 119-201 None
5me0 X-ray 13.5 C 120-202 None
5me1 X-ray 13.5 C 120-202 None
6xe0 X-ray 6.8 B 119-201 None
5uz4 X-ray 5.8 C 119-201 None
6nqb X-ray 3.8 C 119-201 None
6w7m X-ray 3.8 C 119-201 None
6w77 X-ray 3.6 C 119-201 None
6w7n X-ray 3.4 C 119-201 None
6w6k X-ray 3.6 C 119-201 None


© NPIDB team 2003 - 2021

text