Pfam domain
Pfam family: Ribosomal_S4 (PF00163.21)
Uniprot AC: P0A7V8
RecName: 30S ribosomal protein S4
Begin-End: 3-95
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYGVQLREKQKVR
RIYGVLERQFRNYYKEAARLKGNTGENLLALLE
Structures of the domain P0A7V8 3-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 D 3-95 None
5no4 X-ray 5.16 D 3-95 None
6w7w X-ray 3.9 C 3-95 None
2ykr X-ray 9.8 D 2-94 None
5no2 X-ray 5.16 D 3-95 None
4a2i X-ray 16.5 D 2-94 None
4adv X-ray 13.5 D 2-94 None
5my1 X-ray 7.6 D 2-94 None
5me0 X-ray 13.5 D 3-95 None
5me1 X-ray 13.5 D 3-95 None
6xe0 X-ray 6.8 C 2-94 None
5uz4 X-ray 5.8 D 2-94 None
6nqb X-ray 3.8 D 2-94 None
6tqo X-ray 3.8 C 3-95 None
6w7m X-ray 3.8 D 3-95 None
6w77 X-ray 3.6 D 3-95 None
6w7n X-ray 3.4 D 2-94 None
6w6k X-ray 3.6 D 2-94 None


© NPIDB team 2003 - 2021

text