Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.17)
Uniprot AC: P0A7W1
RecName: 30S ribosomal protein S5
Begin-End: 87-157
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLEN
MNSPEMVAAKR
Structures of the domain P0A7W1 87-157
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 E 87-157 None
5no4 X-ray 5.16 E 87-157 None
6w7w X-ray 3.9 D 87-157 None
2ykr X-ray 9.8 E 86-156 None
5no2 X-ray 5.16 E 87-157 None
4a2i X-ray 16.5 E 86-156 None
4adv X-ray 13.5 E 86-156 None
5my1 X-ray 7.6 E 86-156 None
5me0 X-ray 13.5 E 87-157 None
5me1 X-ray 13.5 E 87-157 None
6xe0 X-ray 6.8 D 86-156 None
5uz4 X-ray 5.8 E 86-156 None
6nqb X-ray 3.8 E 86-156 None
6w7m X-ray 3.8 E 87-157 None
6w77 X-ray 3.6 E 87-157 None
6w7n X-ray 3.4 E 86-156 None
6w6k X-ray 3.6 E 86-156 None


© NPIDB team 2003 - 2021

text