Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: P0A7W7
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLK
YFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGE
IICYVA
Structures of the domain P0A7W7 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1s03 X-ray 2.7 G 4-129 None
1s03 X-ray 2.7 H 4-129 None
5no3 X-ray 5.16 H 5-130 None
5no4 X-ray 5.16 H 5-130 None
6w7w X-ray 3.9 G 5-130 None
2ykr X-ray 9.8 H 4-129 None
5no2 X-ray 5.16 H 5-130 None
4a2i X-ray 16.5 H 4-129 None
4adv X-ray 13.5 H 4-129 None
5my1 X-ray 7.6 H 4-129 None
5me0 X-ray 13.5 H 5-130 None
5me1 X-ray 13.5 H 5-130 None
6xe0 X-ray 6.8 G 4-129 None
6w7m X-ray 3.8 H 5-130 None
6w77 X-ray 3.6 H 5-130 None
6w7n X-ray 3.4 H 4-129 None
6w6k X-ray 3.6 H 4-129 None


© NPIDB team 2003 - 2021

text