Pfam domain
Pfam family: RNA_pol_A_CTD (PF03118.17)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 238-304
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGK
KSLTEIK
Structures of the domain P0A7Z4 238-304
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wr6 X-ray 4.14 A 243-309  H-Bb L-Bb 
6wr6 X-ray 4.14 B 243-309  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text