Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 24-223
Organism: Escherichia coli
Interaction Mode:   

Sequence:
AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILL
NLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENASISMR
IKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVI
EMETNGTIDPEEAIRRAATI
Structures of the domain P0A7Z4 24-223
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 A 29-228 None
6wr6 X-ray 4.14 A 29-228 None
6wrg X-ray 3.58 A 29-228 None
6wr8 X-ray 3.53 A 29-228 None


© NPIDB team 2003 - 2021

text