Pfam domain
Pfam family: RNA_pol_A_CTD (PF03118.17)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 243-309
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTE
IKDVLAS
Structures of the domain P0A7Z4 243-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iyd X-ray 19.8 A 243-309  H-Bb 
6tqn X-ray 3.8 U 243-309 None
6z9s X-ray 4.4 V 243-309 None
6z9p X-ray 3.9 U 243-309 None
7ade X-ray 4.2 V 243-309 None
6n4c X-ray 17 B 243-309  H-Bb H-Mj L-Bb L-Mj 
6n4c X-ray 17 A 243-309  L-Mj 
6tqo X-ray 3.8 U 243-309 None
7adc X-ray 4 V 243-309 None
6z9t X-ray 4.1 V 243-309 None
7khc X-ray 4.14 B 243-309  L-Bb 
7khc X-ray 4.14 A 243-309  H-Bb L-Bb 
7add X-ray 4.3 V 243-309 None
7adb X-ray 4.4 U 243-309 None
6z9r X-ray 4.1 V 243-309 None
6z9q X-ray 5.7 V 243-309 None


© NPIDB team 2003 - 2021

text