Pfam domain
Pfam family: RNA_pol_A_CTD (PF03118.17)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 250-309
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS
Structures of the domain P0A7Z4 250-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xs9 NMR D 253-308 None
7c17 X-ray 4.22 A 251-308  H-Bb 
1lb2 X-ray 3.1 B 253-308 None
1lb2 X-ray 3.1 E 253-308 None
6psu X-ray 3.9 M 253-308  H-Mj H-Mn L-Bb 
6gh5 X-ray 3.4 A 251-308 None
6psv X-ray 3.5 M 253-308  L-Bb 
6psw X-ray 3.7 M 253-308  H-Bb L-Bb 
6pst X-ray 3 M 253-308  H-Bb L-Bb 
7c97 X-ray 3.68 K 253-307  H-Mn 
6pss X-ray 3.5 M 253-308  H-Bb L-Bb 
6flq X-ray 4.1 A 252-308 None
6flq X-ray 4.1 B 252-308 None
6oul X-ray 3.4 R 253-308  L-Bb 
6psr X-ray 3.4 M 253-308  H-Bb L-Bb 
6psq X-ray 3.4 M 253-308  H-Bb L-Bb 
7chw X-ray 3.58 K 253-307 None
3n97 X-ray 3.25 B 253-308  H-Bb L-Bb 
3n97 X-ray 3.25 C 253-308  H-Bb L-Bb 
3n4m X-ray 2.99 C 253-308  H-Bb L-Bb 
3n4m X-ray 2.99 B 253-308  H-Bb L-Bb 
5ciz X-ray 5.01 B 253-308  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text