Pfam domain
Pfam family: RNA_pol_A_CTD (PF03118.17)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 264-309
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS
Structures of the domain P0A7Z4 264-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xav X-ray 7.7 K 232-309 None
6xas X-ray 3.8 K 232-309 None


© NPIDB team 2003 - 2021

text