Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 53-181
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTA
ADITHDGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLL
VDACYSPVE
Structures of the domain P0A7Z4 53-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 B 58-185 None
6wr6 X-ray 4.14 A 58-186 None
6wrg X-ray 3.58 B 58-185 None


© NPIDB team 2003 - 2021

text