Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 58-186
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITH
DGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACY
SPVERIAYN
Structures of the domain P0A7Z4 58-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ri9 X-ray 3.7 A 60-156 None
6ri9 X-ray 3.7 B 60-156 None
5vt0 X-ray 3.78 G 60-156 None
5vt0 X-ray 3.78 H 60-156 None
6rin X-ray 3.7 A 60-156 None
6rin X-ray 3.7 B 60-156 None
4ylp X-ray 5.5 A 60-156 None
4ylp X-ray 5.5 B 60-156 None
4ylp X-ray 5.5 G 60-156 None
4ylp X-ray 5.5 H 60-156 None
4ylp X-ray 5.5 N 60-156 None
4ylp X-ray 5.5 M 60-156 None
6asx X-ray 3.8 H 60-156 None
6asx X-ray 3.8 G 60-156 None
6pmi X-ray 3.86 B 60-156 None
6pmi X-ray 3.86 A 60-156 None
3iyd X-ray 19.8 B 60-156 None
3iyd X-ray 19.8 A 60-156 None
6ldi X-ray 3.69 A 60-156 None
6ldi X-ray 3.69 B 60-156 None
5ms0 X-ray 9.8 B 60-156 None
5ms0 X-ray 9.8 A 60-156 None
7c17 X-ray 4.22 A 60-156 None
7c17 X-ray 4.22 B 60-156 None
6pb5 X-ray 4.52 B 60-156 None
6pb5 X-ray 4.52 A 60-156 None
7khe X-ray 3.58 A 60-156 None
7khe X-ray 3.58 B 60-156 None
6kj6 X-ray 3.8 B 60-156 None
6kj6 X-ray 3.8 A 60-155 None
6tqn X-ray 3.8 V 60-156 None
6tqn X-ray 3.8 U 60-156 None
6k4y X-ray 3.79 B 60-156 None
6k4y X-ray 3.79 A 60-156 None
6psu X-ray 3.9 H 60-156 None
6psu X-ray 3.9 G 60-156 None
6n61 X-ray 3.25 A 60-156 None
6n61 X-ray 3.25 B 60-156 None
6gh5 X-ray 3.4 B 60-156 None
6gh5 X-ray 3.4 A 60-156 None
6z9s X-ray 4.4 V 60-156 None
6z9s X-ray 4.4 U 60-156 None
6alg X-ray 3.7 G 60-156 None
6alg X-ray 3.7 H 60-156 None
6z9p X-ray 3.9 V 60-156 None
6z9p X-ray 3.9 U 60-156 None
6rip X-ray 3.4 B 60-156 None
6rip X-ray 3.4 A 60-156 None
6gfw X-ray 3.7 B 60-156 None
6gfw X-ray 3.7 A 60-156 None
6psv X-ray 3.5 G 60-156 None
6psv X-ray 3.5 H 60-156 None
6psw X-ray 3.7 G 60-156 None
6psw X-ray 3.7 H 60-156 None
5ipl X-ray 3.6 B 60-156 None
5ipl X-ray 3.6 A 60-156 None
5ipm X-ray 4.2 B 60-156 None
5ipm X-ray 4.2 A 60-156 None
5ipn X-ray 4.61 B 60-156 None
5ipn X-ray 4.61 A 60-156 None
6alf X-ray 4.1 G 60-156 None
6alf X-ray 4.1 H 60-156 None
4s20 X-ray 4.7 F 60-156 None
4s20 X-ray 4.7 G 60-156 None
4s20 X-ray 4.7 A 60-156 None
4s20 X-ray 4.7 B 60-156 None
6n60 X-ray 3.68 A 60-156 None
6n60 X-ray 3.68 B 67-156 None
6c6s X-ray 3.7 G 60-156 None
6c6s X-ray 3.7 H 60-156 None
6jbq X-ray 4.02 B 60-156 None
6jbq X-ray 4.02 A 60-156 None
6p18 X-ray 3.5 B 60-156 None
6p18 X-ray 3.5 A 60-156 None
6ca0 X-ray 5.75 B 60-156 None
6ca0 X-ray 5.75 A 60-156 None
6pst X-ray 3 G 60-156 None
6pst X-ray 3 H 60-156 None
6flp X-ray 4.1 B 60-156 None
6flp X-ray 4.1 A 60-156 None
7ade X-ray 4.2 V 60-156 None
7ade X-ray 4.2 U 60-156 None
6alh X-ray 4.4 G 60-156 None
6alh X-ray 4.4 H 60-156 None
5my1 X-ray 7.6 W 60-156 None
5my1 X-ray 7.6 V 60-156 None
7khi X-ray 3.62 A 60-156 None
7khi X-ray 3.62 B 60-156 None
6jnx X-ray 4.08 A 60-156 None
6jnx X-ray 4.08 B 60-156 None
6rh3 X-ray 3.6 A 60-156 None
6rh3 X-ray 3.6 B 60-156 None
6bjs X-ray 5.5 G 60-156 None
6bjs X-ray 5.5 H 60-156 None
6pmj X-ray 3.91 B 60-156 None
6pmj X-ray 3.91 A 60-156 None
7c97 X-ray 3.68 B 60-156 None
7c97 X-ray 3.68 A 60-156 None
6xav X-ray 7.7 K 60-156 None
6xav X-ray 7.7 H 60-156 None
6pss X-ray 3.5 G 60-156 None
6pss X-ray 3.5 H 60-156 None
5nss X-ray 5.8 B 60-156 None
5nss X-ray 5.8 A 60-156 None
6ri7 X-ray 3.9 B 60-156 None
6ri7 X-ray 3.9 A 60-156 None
6flq X-ray 4.1 A 60-156 None
6flq X-ray 4.1 B 60-156 None
6p19 X-ray 3.8 B 60-156 None
6p19 X-ray 3.8 A 60-156 None
6c6t X-ray 3.5 H 60-156 None
6c6t X-ray 3.5 G 60-156 None
6oul X-ray 3.4 H 60-156 None
6oul X-ray 3.4 G 60-156 None
6c6u X-ray 3.7 H 60-156 None
6c6u X-ray 3.7 G 60-156 None
6psr X-ray 3.4 G 60-156 None
6psr X-ray 3.4 H 60-156 None
5nsr X-ray 3.8 A 60-156 None
5nsr X-ray 3.8 B 60-156 None
6psq X-ray 3.4 H 60-156 None
6psq X-ray 3.4 G 60-156 None
6n4c X-ray 17 B 60-156  L-Bb 
6n4c X-ray 17 A 67-19 None
6omf X-ray 3.26 B 60-156 None
6omf X-ray 3.26 A 60-156 None
6gh6 X-ray 4.1 B 60-156 None
6gh6 X-ray 4.1 A 60-156 None
7chw X-ray 3.58 B 60-156 None
7chw X-ray 3.58 A 60-156 None
6tqo X-ray 3.8 V 60-156 None
6tqo X-ray 3.8 U 60-156 None
7adc X-ray 4 V 60-156 None
7adc X-ray 4 U 60-156 None
6z9t X-ray 4.1 U 60-156 None
6z9t X-ray 4.1 V 60-156 None
7khc X-ray 4.14 B 60-156 None
7khc X-ray 4.14 A 60-156 None
7add X-ray 4.3 V 60-156 None
7add X-ray 4.3 U 60-156 None
6xas X-ray 3.8 K 60-156 None
6xas X-ray 3.8 H 60-156 None
7adb X-ray 4.4 U 60-156 None
7adb X-ray 4.4 V 60-156 None
6pb6 X-ray 4.29 A 60-156 None
6pb6 X-ray 4.29 B 60-156 None
6z9r X-ray 4.1 U 60-156 None
6z9r X-ray 4.1 V 60-156 None
7khb X-ray 3.53 A 60-156 None
7khb X-ray 3.53 B 60-156 None
6pb4 X-ray 4.35 A 60-156 None
6pb4 X-ray 4.35 B 60-156 None
6z9q X-ray 5.7 U 60-156 None
6z9q X-ray 5.7 V 60-156 None


© NPIDB team 2003 - 2021

text