Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: P0A7Z6
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 58-186
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
EVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITH
DGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACY
SPVERIAYN
Structures of the domain P0A7Z6 58-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 A 58-185 None
6n62 X-ray 3.8 B 58-186 None
6gov X-ray 3.7 U 58-178 None
6gov X-ray 3.7 V 58-186 None
6b6h X-ray 3.9 B 58-185 None
6b6h X-ray 3.9 A 58-178 None


© NPIDB team 2003 - 2021

text