Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: P0A800
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain P0A800 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ri9 X-ray 3.7 E 8-60 None
5vt0 X-ray 3.78 K 8-60 None
6rin X-ray 3.7 E 8-60 None
4ylp X-ray 5.5 E 8-60 None
4ylp X-ray 5.5 K 8-60 None
4ylp X-ray 5.5 Q 8-60 None
6asx X-ray 3.8 K 8-60 None
6pmi X-ray 3.86 E 8-60 None
3iyd X-ray 19.8 E 8-60 None
6ldi X-ray 3.69 E 8-60 None
5ms0 X-ray 9.8 O 8-60 None
7c17 X-ray 4.22 E 8-60 None
6pb5 X-ray 4.52 E 8-60 None
7khe X-ray 3.58 E 8-60 None
6kj6 X-ray 3.8 E 8-60 None
6tqn X-ray 3.8 W 8-60 None
6k4y X-ray 3.79 E 8-60 None
6psu X-ray 3.9 K 8-60 None
6n61 X-ray 3.25 E 8-60 None
6gh5 X-ray 3.4 E 8-60 None
6z9s X-ray 4.4 W 8-60 None
6alg X-ray 3.7 K 8-60 None
6z9p X-ray 3.9 W 8-60 None
6rip X-ray 3.4 E 8-60 None
6gfw X-ray 3.7 E 8-60 None
6psv X-ray 3.5 K 8-60 None
6psw X-ray 3.7 K 8-60 None
5ipl X-ray 3.6 E 8-60 None
5ipm X-ray 4.2 E 8-60 None
5ipn X-ray 4.61 E 8-60 None
6alf X-ray 4.1 K 8-60 None
6n60 X-ray 3.68 E 8-60 None
6c6s X-ray 3.7 K 8-60 None
6jbq X-ray 4.02 E 8-60 None
6p18 X-ray 3.5 E 8-60 None
6ca0 X-ray 5.75 E 8-60 None
6wrd X-ray 3.62 E 8-60 None
6pst X-ray 3 K 8-60 None
6flp X-ray 4.1 E 8-60 None
7ade X-ray 4.2 W 8-60 None
6alh X-ray 4.4 K 8-60 None
6wr6 X-ray 4.14 E 8-60 None
5my1 X-ray 7.6 Z 8-60 None
7khi X-ray 3.62 E 8-60 None
6jnx X-ray 4.08 E 8-60 None
6bjs X-ray 5.5 K 8-60 None
6pmj X-ray 3.91 E 8-60 None
7c97 X-ray 3.68 E 8-60 None
6xav X-ray 7.7 W 8-56 None
6pss X-ray 3.5 K 8-60 None
5nss X-ray 5.8 E 8-60 None
6ri7 X-ray 3.9 E 8-60 None
6flq X-ray 4.1 E 8-60 None
6p19 X-ray 3.8 E 8-60 None
6c6t X-ray 3.5 K 8-60 None
6oul X-ray 3.4 K 8-60 None
6wrg X-ray 3.58 E 8-60 None
6c6u X-ray 3.7 K 8-60 None
6wr8 X-ray 3.53 E 8-60 None
6psr X-ray 3.4 K 8-60 None
5nsr X-ray 3.8 E 8-60 None
6psq X-ray 3.4 K 8-60 None
6n4c X-ray 17 E 8-60 None
6omf X-ray 3.26 E 8-60 None
6gh6 X-ray 4.1 E 8-60 None
7chw X-ray 3.58 E 8-60 None
6tqo X-ray 3.8 W 8-60 None
7adc X-ray 4 W 8-60 None
6z9t X-ray 4.1 W 8-60 None
7khc X-ray 4.14 E 8-60 None
7add X-ray 4.3 W 8-60 None
6xas X-ray 3.8 W 8-56 None
7adb X-ray 4.4 W 8-60 None
6pb6 X-ray 4.29 E 8-60 None
6z9r X-ray 4.1 W 8-60 None
7khb X-ray 3.53 E 8-60 None
6pb4 X-ray 4.35 E 8-60 None
6z9q X-ray 5.7 W 8-60 None


© NPIDB team 2003 - 2021

text