Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: P0A802
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain P0A802 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 E 8-60 None
6gov X-ray 3.7 W 8-60 None
6wmu X-ray 3.18 E 8-60 None


© NPIDB team 2003 - 2021

text