Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 15-342
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGK
YKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRD
IERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDL
EQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVP
LDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGR
AITGSNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain P0A8T7 15-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ri9 X-ray 3.7 D 16-342  H-Bb H-Mj L-Bb 
5vt0 X-ray 3.78 J 16-342 None
6rin X-ray 3.7 D 16-342 None
4ylp X-ray 5.5 D 15-342 None
4ylp X-ray 5.5 J 15-342 None
4ylp X-ray 5.5 P 15-342 None
6asx X-ray 3.8 J 16-342  H-Bb H-Mj L-Bb L-Mj 
3iyd X-ray 19.8 D 15-342 None
6ldi X-ray 3.69 D 17-342  L-Bb 
5ms0 X-ray 9.8 D 14-342  L-Mn 
7c17 X-ray 4.22 D 17-342  L-Bb L-Mj 
7khe X-ray 3.58 D 14-342  L-Bb 
6tqn X-ray 3.8 Y 16-342 None
6k4y X-ray 3.79 D 16-342  H-Bb H-Mj L-Bb 
6psu X-ray 3.9 J 16-342  L-Bb 
6n61 X-ray 3.25 D 17-342  L-Bb 
6gh5 X-ray 3.4 D 14-342 None
6alg X-ray 3.7 J 16-342  H-Bb H-Mj S-Mj L-Bb 
6rip X-ray 3.4 D 16-342  H-Bb L-Bb 
6gfw X-ray 3.7 D 14-342 None
6psv X-ray 3.5 J 16-342  H-Bb L-Bb 
6psw X-ray 3.7 J 16-342  H-Bb L-Bb 
5ipl X-ray 3.6 D 15-342 None
5ipm X-ray 4.2 D 15-342 None
5ipn X-ray 4.61 D 15-342 None
6alf X-ray 4.1 J 16-342  H-Bb H-Mj L-Bb L-Mj 
6n60 X-ray 3.68 D 16-342  L-Bb 
6c6s X-ray 3.7 J 16-342  H-Bb H-Mj L-Bb 
6jbq X-ray 4.02 D 16-342  L-Bb 
6p18 X-ray 3.5 D 15-342 None
6ca0 X-ray 5.75 D 14-342 None
4ylo X-ray 6 D 15-342 None
4ylo X-ray 6 J 15-342 None
4ylo X-ray 6 P 15-342 None
6pst X-ray 3 J 16-342 None
6flp X-ray 4.1 D 16-342  H-Bb L-Bb 
6alh X-ray 4.4 J 16-342  H-Bb H-Mj L-Bb L-Mj 
5my1 X-ray 7.6 Y 14-342 None
7khi X-ray 3.62 D 14-342 None
6jnx X-ray 4.08 D 16-342  L-Bb 
6rh3 X-ray 3.6 D 16-342  H-Bb H-Mj L-Bb 
6bjs X-ray 5.5 J 16-342  H-Mj L-Bb 
7c97 X-ray 3.68 D 14-345  H-Mj 
6xav X-ray 7.7 J 14-342  H-Bb 
6pss X-ray 3.5 J 16-342  L-Bb 
5nss X-ray 5.8 D 15-342 None
6ri7 X-ray 3.9 D 16-342  H-Bb L-Bb 
6flq X-ray 4.1 D 16-342  L-Bb 
6p19 X-ray 3.8 D 15-342 None
6c6t X-ray 3.5 J 16-342  H-Bb H-Mj L-Bb 
6c6u X-ray 3.7 J 15-342  H-Bb L-Bb 
6psr X-ray 3.4 J 16-342 None
5nsr X-ray 3.8 D 15-342 None
6psq X-ray 3.4 J 16-342 None
6n4c X-ray 17 D 15-342  H-Bb H-Mj L-Bb L-Mn 
6omf X-ray 3.26 D 16-342  H-Bb L-Bb 
6gh6 X-ray 4.1 D 14-342 None
7chw X-ray 3.58 D 17-341  H-Mj 
6tqo X-ray 3.8 Y 16-342 None
7khc X-ray 4.14 D 14-342  H-Bb L-Bb 
6wmu X-ray 3.18 D 14-342  H-Bb L-Bb 
6xas X-ray 3.8 J 14-342 None
7khb X-ray 3.53 D 14-342  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text