Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 179-276
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMI
LTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
Structures of the domain P0A8T7 179-276
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kj6 X-ray 3.8 D 193-342 None


© NPIDB team 2003 - 2021

text