Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 2-330
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARI
FGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLP
SRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMG
AEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTV
LPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQE
AVDALLDNGRRGRAITGSNKRPLKSLADM
Structures of the domain P0A8T7 2-330
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 D 14-342  L-Bb 
6wr6 X-ray 4.14 D 14-342  H-Bb L-Bb 
6wrg X-ray 3.58 D 14-342  L-Bb 
6wr8 X-ray 3.53 D 14-342  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text