Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 374-474
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLG
IQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTL
Structures of the domain P0A8T7 374-474
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 D 386-486 None
6wr6 X-ray 4.14 D 386-486 None
6wrg X-ray 3.58 D 386-486 None
6wr8 X-ray 3.53 D 386-486 None


© NPIDB team 2003 - 2021

text