Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 477-632
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERL
YRSGLASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQAL
GKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYA
Structures of the domain P0A8T7 477-632
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 D 489-644 None
6wr6 X-ray 4.14 D 489-644 None
6wrg X-ray 3.58 D 489-644 None
6wr8 X-ray 3.53 D 489-644 None


© NPIDB team 2003 - 2021

text