Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: P0A8T8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 15-342
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
EEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGK
YKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRD
IERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDL
EQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVP
LDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGR
AITGSNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain P0A8T8 15-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pmi X-ray 3.86 D 15-342  H-Bb 
6pb5 X-ray 4.52 D 15-342  L-Bb 
6n62 X-ray 3.8 D 16-342 None
6gov X-ray 3.7 Y 14-342 None
6b6h X-ray 3.9 D 15-342  H-Bb L-Bb 
6pmj X-ray 3.91 D 15-342 None
6pb6 X-ray 4.29 D 15-342  H-Bb L-Bb 
6pb4 X-ray 4.35 D 15-342  H-Bb 


© NPIDB team 2003 - 2021

text