Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: P0A8T8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 386-486
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
ELRGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGK
AIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMS
Structures of the domain P0A8T8 386-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pmi X-ray 3.86 D 386-486 None
6pb5 X-ray 4.52 D 386-486 None
6n62 X-ray 3.8 D 386-486 None
6gov X-ray 3.7 Y 386-486 None
6b6h X-ray 3.9 D 386-486 None
6pmj X-ray 3.91 D 386-486 None
6pb6 X-ray 4.29 D 386-486 None
6pb4 X-ray 4.35 D 386-486 None


© NPIDB team 2003 - 2021

text