Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.16)
Uniprot AC: P0A8V2
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 143-355
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRR
KLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVY
VEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLL
AKLSQSGHKRIETLFTNDLDHGPYISETLRVDP
Structures of the domain P0A8V2 143-355
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iyd X-ray 19.8 C 151-454 None


© NPIDB team 2003 - 2021

text