Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.16)
Uniprot AC: P0A8V2
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 150-334
Organism: Escherichia coli
Interaction Mode:   

Sequence:
HRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATII
LRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRI
TARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSG
HKRIE
Structures of the domain P0A8V2 150-334
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s20 X-ray 4.7 H 151-454 None
4s20 X-ray 4.7 C 151-454 None


© NPIDB team 2003 - 2021

text