Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: P0A8V2
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 513-581
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLI
NSLSVYAQT
Structures of the domain P0A8V2 513-581
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ri9 X-ray 3.7 C 513-580 None
5vt0 X-ray 3.78 I 513-580 None
6rin X-ray 3.7 C 513-580 None
4ylp X-ray 5.5 C 513-580 None
4ylp X-ray 5.5 I 513-580 None
4ylp X-ray 5.5 O 513-580 None
6asx X-ray 3.8 I 513-580  L-Mj 
3iyd X-ray 19.8 C 513-580 None
6ldi X-ray 3.69 C 513-580  L-Mj 
5ms0 X-ray 9.8 C 513-580 None
7c17 X-ray 4.22 C 513-580  L-Bb L-Mn 
7khe X-ray 3.58 C 513-580  L-Mj 
6kj6 X-ray 3.8 C 513-580  L-Mj L-Mn 
6tqn X-ray 3.8 X 513-580 None
6k4y X-ray 3.79 C 513-580  L-Mj L-Mn 
6psu X-ray 3.9 I 513-580 None
6n61 X-ray 3.25 C 513-580 None
6gh5 X-ray 3.4 C 513-580 None
6alg X-ray 3.7 I 513-580  L-Mj L-Mn 
6rip X-ray 3.4 C 513-580 None
6gfw X-ray 3.7 C 513-580 None
6psv X-ray 3.5 I 513-580  L-Mj 
6psw X-ray 3.7 I 513-580  L-Bb L-Mj L-Mn 
5ipl X-ray 3.6 C 513-580 None
5ipm X-ray 4.2 C 513-580  H-Mj 
5ipn X-ray 4.61 C 513-580 None
6alf X-ray 4.1 I 513-580  L-Mj L-Mn 
4s20 X-ray 4.7 H 513-580 None
4s20 X-ray 4.7 C 513-580 None
6n60 X-ray 3.68 C 513-580 None
6c6s X-ray 3.7 I 513-580  L-Mj L-Mn 
6jbq X-ray 4.02 C 513-580  L-Mj L-Mn 
6p18 X-ray 3.5 C 513-580  L-Mj L-Mn 
6ca0 X-ray 5.75 C 513-580 None
6wrd X-ray 3.62 C 513-580 None
6pst X-ray 3 I 513-580 None
6flp X-ray 4.1 C 513-580  L-Bb L-Mj 
6alh X-ray 4.4 I 513-580  L-Bb L-Mj L-Mn 
6wr6 X-ray 4.14 C 513-580  L-Mj 
5my1 X-ray 7.6 X 513-580 None
7khi X-ray 3.62 C 513-580 None
6jnx X-ray 4.08 C 513-580  L-Mj L-Mn 
6rh3 X-ray 3.6 C 513-580 None
6bjs X-ray 5.5 I 513-580  H-Mj 
7c97 X-ray 3.68 C 513-580  L-Bb L-Mj L-Mn 
6xav X-ray 7.7 I 513-580  L-Bb L-Mn 
6pss X-ray 3.5 I 513-580 None
5nss X-ray 5.8 C 513-580 None
6ri7 X-ray 3.9 C 513-580 None
6flq X-ray 4.1 C 513-580  L-Bb L-Mj 
6p19 X-ray 3.8 C 513-580  L-Mj 
6c6t X-ray 3.5 I 513-580  L-Mj L-Mn 
6oul X-ray 3.4 I 513-580  L-Bb 
6wrg X-ray 3.58 C 513-580  L-Mj 
6c6u X-ray 3.7 I 513-580  L-Mj L-Mn 
6wr8 X-ray 3.53 C 513-580  L-Bb L-Mj 
6psr X-ray 3.4 I 513-580 None
5nsr X-ray 3.8 C 513-580 None
6psq X-ray 3.4 I 513-580 None
6n4c X-ray 17 C 513-580 None
6omf X-ray 3.26 C 513-580  L-Mj L-Mn 
6gh6 X-ray 4.1 C 513-580 None
7chw X-ray 3.58 C 513-580  L-Bb L-Mj 
6tqo X-ray 3.8 X 513-580 None
7khc X-ray 4.14 C 513-580  L-Mj L-Mn 
6xas X-ray 3.8 I 513-580 None
7khb X-ray 3.53 C 513-580  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text