Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.17)
Uniprot AC: P0A8V4
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 26-500
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
YLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQEC
QIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVI
VSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLP
ATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEK
GRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKL
SQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLF
ENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDI
DHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISA
Structures of the domain P0A8V4 26-500
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 C 26-500 None
6z9s X-ray 4.4 X 26-500 None
6z9p X-ray 3.9 X 26-500 None
6gov X-ray 3.7 X 26-500 None
7ade X-ray 4.2 X 26-500 None
7adc X-ray 4 X 26-500 None
6z9t X-ray 4.1 X 26-500 None
7add X-ray 4.3 X 26-500 None
6wmu X-ray 3.18 C 26-500  L-Bb 
7adb X-ray 4.4 X 26-500 None
6z9r X-ray 4.1 X 26-500 None
6z9q X-ray 5.7 X 26-500 None


© NPIDB team 2003 - 2021

text