Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P0A9G4
RecName: HTH-type transcriptional regulator CueR
Begin-End: 2-68
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
NISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLE
ESGELVN
Structures of the domain P0A9G4 2-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wls X-ray 2.11 A 2-69  H-Bb H-Mj L-Bb 
4wls X-ray 2.11 B 2-69  H-Bb H-Mj L-Bb L-Mn 
4wlw X-ray 2.8 A 2-69  H-Bb H-Mj L-Bb L-Mn 
4wlw X-ray 2.8 A 2-69 None


© NPIDB team 2003 - 2021

text