Pfam domain
Pfam family: Thioredoxin (PF00085.22)
Uniprot AC: P0AA25
RecName: Thioredoxin 1
Begin-End: 4-106
Organism: Escherichia coli
Interaction Mode:  L-Bb 

Sequence:
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQ
NPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDA
Structures of the domain P0AA25 4-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zyq X-ray 2.7 B 3-105 None
1tkd X-ray 2.49 B 3-105 None
1x9s X-ray 2.7 B 3-105 None
1x9m X-ray 2.1 B 3-105 None
2ajq X-ray 2.6 I 3-105 None
2ajq X-ray 2.6 B 3-105  L-Bb 
1skr X-ray 2.4 B 3-105 None
1sks X-ray 2.3 B 3-105 None
1skw X-ray 2.3 B 3-105 None
1sl0 X-ray 3.2 B 3-105 None
1sl0 X-ray 3.2 D 3-105 None
1t8e X-ray 2.54 B 3-105  L-Bb 
1tk0 X-ray 2.3 B 3-105 None
1tk5 X-ray 2.2 B 3-105 None
1tk8 X-ray 2.5 B 3-105 None
1x9w X-ray 2.3 B 3-105 None
1sl1 X-ray 2.2 B 3-105 None
1sl2 X-ray 2.3 B 3-105 None
1t7p X-ray 2.2 B 3-105 None
6n7w X-ray 4.5 I 3-105 None
6p7e X-ray 3 E 3-105 None
6p7e X-ray 3 F 3-105 None
6p7e X-ray 3 G 3-105  L-Bb 
6p7e X-ray 3 H 3-105 None


© NPIDB team 2003 - 2021

text