Pfam domain
Pfam family: zf-dskA_traR (PF01258.19)
Uniprot AC: P0ABS1
RecName: RNA polymerase-binding transcription factor DksA
Begin-End: 101-136
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCI
Structures of the domain P0ABS1 101-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 M 109-144 None
6wrg X-ray 3.58 M 109-144 None


© NPIDB team 2003 - 2021

text