Pfam domain
Pfam family: GST_C (PF00043.27)
Uniprot AC: P0ACA3
RecName: Stringent starvation protein A
Begin-End: 101-194
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCY
LAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERD
Structures of the domain P0ACA3 101-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7c97 X-ray 3.68 I 101-194 None
7c97 X-ray 3.68 J 101-194 None


© NPIDB team 2003 - 2021

text